(Mackie laboratory, Indiana University Bloomington; Indiana; USA Cat# mMAGL, RRID:AB_2813826)
Comments
"A GST fusion protein expression construct was produced by inserting the DNA coding for a 35-amino acid peptide (PNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLK) from mouse MGL (mMGL) or a 38-amino acid peptide (DMPGHEGTTRSSLDDLSIVGQVKRIHQFVECLKLNKKP) from mouse ABHD6 (mABHD6) into the pGEX-3X vector at BamHI and EcoRI restriction sites. Each fusion protein was purified from BL21 Escherichia coli lysates on a glutathione Sepharose column and was injected into two rabbits to generate antisera (Cocalico Biologicals, Inc., Reamstown, PA) using standard approaches (Bodor et al., 2005). The antiserum was purified in two steps, first by removal of GST antibodies with a GST column and then by binding to and elution from an affinity column made with the injected GST fusion protein."
Vendor
Mackie laboratory, Indiana University Bloomington; Indiana; USA