Showing 1 - 2 results out of 2 with the query:
AB_10599176
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-ALDH6A1 antibody produced in rabbit
ALDH6A1 antibody produced in rabbit human
Sigma-Aldrich
HPA029072
(Sigma-Aldrich Cat# HPA029072, RRID:AB_10599176)
polyclonal antibody
rabbit
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Western Blot; Other
6d4ab506-4e10-5912-8e9b-5f970f449167
Anti-ALDH6A1 polyclonal antibody
ALDH6A1 See NCBI gene human, rat, mouse
Atlas Antibodies
HPA029072
(Atlas Antibodies Cat# HPA029072, RRID:AB_10599176)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSIT; Manufacturer approved use: IHC, WB
4704686e-abef-5e3e-ac11-2bb51c1deeb7