Showing 1 - 2 results out of 2 with the query:
AB_10600422
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-BCL2L15 antibody produced in rabbit
BCL2L15 antibody produced in rabbit human
Sigma-Aldrich
HPA029733
(Sigma-Aldrich Cat# HPA029733, RRID:AB_10600422)
polyclonal antibody
rabbit
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
38e2547f-952f-5e98-9e20-99bff2b41f8c
Anti-BCL2L15 polyclonal antibody
BCL2L15 See NCBI gene human
Atlas Antibodies
HPA029733
(Atlas Antibodies Cat# HPA029733, RRID:AB_10600422)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QTGAILQNTVESLSKTWCAQDSSLAYERAFLAVSVKLLEYMAHIAPEVVGQVAIPMTGMINGNQAIREFIQGQGGWE; Manufacturer approved use: IHC
d6c39f0e-73e4-5c23-8a76-c2e6dae4d7d8