Showing 1 - 2 results out of 2 with the query:
AB_10600801
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-CLEC16A antibody produced in rabbit
CLEC16A antibody produced in rabbit human
Sigma-Aldrich
HPA035814
(Sigma-Aldrich Cat# HPA035814, RRID:AB_10600801)
polyclonal antibody
rabbit
Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-CLEC16A polyclonal antibody
CLEC16A See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035814
(Atlas Antibodies Cat# HPA035814, RRID:AB_10600801)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPYFSNLVWFIGSHVIELDDCVQTDEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLTDHLLNRLFLPLYVYSLENQDKGGERPKISLPVSLYLLSQVFL; Manufacturer approved use: IHC