Showing 1 - 2 results out of 2 with the query:
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Clone ID
Host Organism
Anti-KIAA0556 antibody produced in rabbit
KIAA0556 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA035090, RRID:AB_10601129)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Anti-KIAA0556 polyclonal antibody
KIAA0556 See NCBI gene human
Atlas Antibodies Go To Vendor
(Atlas Antibodies Cat# HPA035090, RRID:AB_10601129)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EPPVDYSDDFELCGDVTLQANNTSEDRPQELRRSLELSVNLQRKQKDCSSDEYDSIEEDILSEPEPEDPALVGHPRHDRPPSSGDWTQKDVHGE; Manufacturer approved use: ICC-IF, IHC