Showing 1 - 2 results out of 2 with the query:
AB_10601217
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-UBR2 antibody produced in rabbit
UBR2 antibody produced in rabbit human
Sigma-Aldrich
HPA027880
(Sigma-Aldrich Cat# HPA027880, RRID:AB_10601217)
polyclonal antibody
rabbit
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Anti-UBR2 polyclonal antibody
UBR2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA027880
(Atlas Antibodies Cat# HPA027880, RRID:AB_10601217)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRV; Manufacturer approved use: ICC-IF, IHC