Showing 1 - 2 results out of 2 with the query:
AB_10601327
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-GPC4 antibody produced in rabbit
GPC4 antibody produced in rabbit human
Sigma-Aldrich
HPA030836
(Sigma-Aldrich Cat# HPA030836, RRID:AB_10601327)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Anti-GPC4 polyclonal antibody
GPC4 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA030836
(Atlas Antibodies Cat# HPA030836, RRID:AB_10601327)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SKMKNAYNGNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADSAGVR; Manufacturer approved use: ICC-IF, IHC