Showing 1 - 2 results out of 2 with the query:
AB_10602034
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-MAMLD1 antibody produced in rabbit
MAMLD1 antibody produced in rabbit human
Sigma-Aldrich
HPA003923
(Sigma-Aldrich Cat# HPA003923, RRID:AB_10602034)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Anti-MAMLD1 polyclonal antibody
MAMLD1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA003923
(Atlas Antibodies Cat# HPA003923, RRID:AB_10602034)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KRPCLEDVTLAMGPGAHPSTACAELQVPPLTINPSPAAMGVAGQSLLLENNPMNGNIMGSPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQELLEELTKIQDPSPNELDLE; Manufacturer approved use: IHC, WB