Showing 1 - 2 results out of 2 with the query:
AB_10602252
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-TTC22 antibody produced in rabbit
TTC22 antibody produced in rabbit human
Sigma-Aldrich
HPA035072
(Sigma-Aldrich Cat# HPA035072, RRID:AB_10602252)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Anti-TTC22 polyclonal antibody
TTC22 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035072
(Atlas Antibodies Cat# HPA035072, RRID:AB_10602252)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GMPDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDAVQELLAVDEAALNQALVFLAKAGESELGATLPELQLLRGKCLRIKGED; Manufacturer approved use: IHC