Showing 1 - 2 results out of 2 with the query:
AB_10603887
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-SLC12A6 antibody produced in rabbit
SLC12A6 antibody produced in rabbit human
Sigma-Aldrich
HPA034563
(Sigma-Aldrich Cat# HPA034563, RRID:AB_10603887)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
f296e1cc-5f79-54ec-a2f3-e0da0072c6bc
Anti-SLC12A6 polyclonal antibody
SLC12A6 See NCBI gene human
Atlas Antibodies
HPA034563
(Atlas Antibodies Cat# HPA034563, RRID:AB_10603887)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDE; Manufacturer approved use: ICC-IF, IHC
6f1dec5d-48d3-5730-aa0d-e8e9f37476df