Showing 1 - 2 results out of 2 with the query:
AB_10670386
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-PSMA1 antibody produced in rabbit
PSMA1 antibody produced in rabbit human
Sigma-Aldrich
HPA037646
(Sigma-Aldrich Cat# HPA037646, RRID:AB_10670386)
polyclonal antibody
rabbit
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
b6d2870b-3538-5152-bf76-9dfef74b6ef7
Anti-PSMA1 polyclonal antibody
PSMA1 See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
HPA037646
(Atlas Antibodies Cat# HPA037646, RRID:AB_10670386)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEP; Manufacturer approved use: ICC-IF, IHC, WB
241bf17a-3e6a-5b60-b89f-db374ba099fc