Showing 1 - 2 results out of 2 with the query:
AB_10670568
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-RAI14 antibody produced in rabbit
RAI14 antibody produced in rabbit human
Sigma-Aldrich
HPA036949
(Sigma-Aldrich Cat# HPA036949, RRID:AB_10670568)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
1f74db2d-efb5-5fd0-8f86-6a96baa84db0
Anti-RAI14 polyclonal antibody
RAI14 See NCBI gene human, mouse
Atlas Antibodies
HPA036949
(Atlas Antibodies Cat# HPA036949, RRID:AB_10670568)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ISPTQLSDVSSPRSITSTPLSGKESVFFAEPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLTLHNKELQDK; Manufacturer approved use: IHC, WB
14c39d5d-d877-59cc-b4b1-c92327a58eb2