Showing 1 - 2 results out of 2 with the query:
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Clone ID
Host Organism
Anti-FAM110C antibody produced in rabbit
FAM110C antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA036144, RRID:AB_10670710)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-FAM110C polyclonal antibody
FAM110C See NCBI gene human
Atlas Antibodies Go To Vendor
(Atlas Antibodies Cat# HPA036144, RRID:AB_10670710)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPVPRTGDEGKAGNPETV; Manufacturer approved use: IHC