Showing 1 - 2 results out of 2 with the query:
AB_10670796
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-GUSB antibody produced in rabbit
GUSB antibody produced in rabbit human
Sigma-Aldrich
HPA036322
(Sigma-Aldrich Cat# HPA036322, RRID:AB_10670796)
polyclonal antibody
rabbit
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
765ebe1b-8d03-523a-a6ce-c01da4888919
Anti-GUSB polyclonal antibody
GUSB See NCBI gene human
Atlas Antibodies
HPA036322
(Atlas Antibodies Cat# HPA036322, RRID:AB_10670796)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTTLPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTS; Manufacturer approved use: ICC-IF, IHC, WB
4b95f1df-366e-5a8d-9417-ca36142d96d6