Showing 1 - 2 results out of 2 with the query:
AB_10671509
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-KIAA0556 antibody produced in rabbit
KIAA0556 antibody produced in rabbit human
Sigma-Aldrich
HPA035089
(Sigma-Aldrich Cat# HPA035089, RRID:AB_10671509)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-KIAA0556 polyclonal antibody
KIAA0556 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035089
(Atlas Antibodies Cat# HPA035089, RRID:AB_10671509)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VVLEFNPASKSHKRERNLSAKRKDNAEVFVPTKPEPNLTPQAPAVFPDQERMCSRPGSRRERPLSATRKTLCEAEYPEEDASAVLQAIQVENA; Manufacturer approved use: IHC