Showing 1 - 2 results out of 2 with the query:
AB_10671519
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-SPATA7 antibody produced in rabbit
SPATA7 antibody produced in rabbit human
Sigma-Aldrich
HPA038083
(Sigma-Aldrich Cat# HPA038083, RRID:AB_10671519)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-SPATA7 polyclonal antibody
SPATA7 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA038083
(Atlas Antibodies Cat# HPA038083, RRID:AB_10671519)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRA; Manufacturer approved use: ICC-IF, IHC, WB