Showing 1 - 2 results out of 2 with the query:
AB_10672344
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-QARS antibody produced in rabbit
QARS antibody produced in rabbit human
Sigma-Aldrich
HPA036986
(Sigma-Aldrich Cat# HPA036986, RRID:AB_10672344)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
4b65b008-2c08-52bb-96f1-1d7c3a03d450
Anti-QARS polyclonal antibody
QARS See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
HPA036986
(Atlas Antibodies Cat# HPA036986, RRID:AB_10672344)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence HTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDA; Manufacturer approved use: ICC-IF, IHC, WB
46cd5dcb-2dbb-5ef0-8cef-496dddeb477b