Showing 1 - 2 results out of 2 with the query:
AB_10672478
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-ZNF638 antibody produced in rabbit
ZNF638 antibody produced in rabbit human
Sigma-Aldrich
HPA036784
(Sigma-Aldrich Cat# HPA036784, RRID:AB_10672478)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
0bf1e728-c08a-5f4d-81c2-e0148498a479
Anti-ZNF638 polyclonal antibody
ZNF638 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA036784
(Atlas Antibodies Cat# HPA036784, RRID:AB_10672478)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GLLKPTSARSGLAESSSKFKPTQSSLTRGGSGRISALQGKLSKLDYRDITKQSQETEARPSIMKRDDSNNKTLAEQNTKNPK; Manufacturer approved use: ICC-IF, IHC
8c1652ee-6c03-5cd7-b67b-c9e0d285bb77