Showing 1 - 2 results out of 2 with the query:
AB_10673295
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-ARHGAP44 antibody produced in rabbit
ARHGAP44 antibody produced in rabbit human
Sigma-Aldrich
HPA038814
(Sigma-Aldrich Cat# HPA038814, RRID:AB_10673295)
polyclonal antibody
rabbit
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
0bf8ff01-7124-58f7-bd2b-49dad28d7617
Anti-ARHGAP44 polyclonal antibody
ARHGAP44 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA038814
(Atlas Antibodies Cat# HPA038814, RRID:AB_10673295)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence STPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSE; Manufacturer approved use: IHC, WB
7ae2543f-af93-5b61-a828-ed5af3d46b5f