Showing 1 - 2 results out of 2 with the query:
AB_10673488
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-DCTD antibody produced in rabbit
DCTD antibody produced in rabbit human
Sigma-Aldrich
HPA035894
(Sigma-Aldrich Cat# HPA035894, RRID:AB_10673488)
polyclonal antibody
rabbit
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
0d4eab12-1049-5cd1-82d2-92bf6519c98a
Anti-DCTD polyclonal antibody
DCTD See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035894
(Atlas Antibodies Cat# HPA035894, RRID:AB_10673488)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHA; Manufacturer approved use: ICC-IF, IHC, WB
ff5239e3-5919-5580-b18e-21ad7ebd5501