Showing 1 - 3 results out of 3 with the query:
AB_1078142
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-A2M antibody produced in rabbit
Human A2M human
Sigma-Aldrich
HPA002265
(Sigma-Aldrich Cat# HPA002265, RRID:AB_1078142)
unknown
rabbit
Vendor recommendations:
Anti-A2M antibody produced in rabbit
A2M antibody produced in rabbit human, human
Sigma-Aldrich
HPA002265
(Sigma-Aldrich Cat# HPA002265, RRID:AB_1078142)
polyclonal antibody
rabbit
Vendor recommendations: Other; Western Blot; Immunohistochemistry; Immunofluorescence; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-A2M polyclonal antibody
A2M See NCBI gene human
Atlas Antibodies Go To Vendor
HPA002265
(Atlas Antibodies Cat# HPA002265, RRID:AB_1078142)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS; Manufacturer approved use: IHC, WB