Showing 1 - 3 results out of 3 with the query:
AB_1078187
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-TNFSF12-TNFSF13 antibody produced in rabbit
Human TNFSF13 human
Sigma-Aldrich
HPA004863
(Sigma-Aldrich Cat# HPA004863, RRID:AB_1078187)
unknown
rabbit
Vendor recommendations:
Anti-TNFSF13 polyclonal antibody
TNFSF13 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA004863
(Atlas Antibodies Cat# HPA004863, RRID:AB_1078187)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LEAWENGERSRKRRAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILS; Manufacturer approved use: IHC, WB
Anti-TNFSF12-TNFSF13 antibody produced in rabbit
TNFSF12-TNFSF13 antibody produced in rabbit human, human
Sigma-Aldrich
HPA004863
(Sigma-Aldrich Cat# HPA004863, RRID:AB_1078187)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable