Showing 1 - 3 results out of 3 with the query:
AB_1078223
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-ASB11 antibody produced in rabbit
Human ASB11 human
Sigma-Aldrich
HPA000238
(Sigma-Aldrich Cat# HPA000238, RRID:AB_1078223)
unknown
rabbit
Vendor recommendations:
af0af53e-aa87-5a44-96e8-92cb94a57870
Anti-ASB11 polyclonal antibody
ASB11 See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
HPA000238
(Atlas Antibodies Cat# HPA000238, RRID:AB_1078223)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLH; Manufacturer approved use: IHC, WB
48418578-a710-573a-a6dc-0f61b87449af
Anti-ASB11 antibody produced in rabbit
ASB11 antibody produced in rabbit human, human
Sigma-Aldrich
HPA000238
(Sigma-Aldrich Cat# HPA000238, RRID:AB_1078223)
polyclonal antibody
rabbit
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
36566dce-a047-5ea8-b54e-a04c5d441fb0