Showing 1 - 3 results out of 3 with the query:
AB_1078249
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-ATRX antibody produced in rabbit
Human ATRX human
Sigma-Aldrich
HPA001906
(Sigma-Aldrich Cat# HPA001906, RRID:AB_1078249)
unknown
rabbit
Vendor recommendations:
e06c8984-374f-529a-9692-c3dfd52a9b64
Anti-ATRX antibody produced in rabbit
ATRX antibody produced in rabbit human, human
Sigma-Aldrich
HPA001906
(Sigma-Aldrich Cat# HPA001906, RRID:AB_1078249)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
03a120ed-11dc-562e-b707-9fac73c9d94d
Anti-ATRX polyclonal antibody
ATRX See NCBI gene human
Atlas Antibodies Go To Vendor
HPA001906
(Atlas Antibodies Cat# HPA001906, RRID:AB_1078249)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR; Manufacturer approved use: IHC, WB
5ab864c5-9d39-52f3-91a5-2cf9fe5c5334