Showing 1 - 3 results out of 3 with the query:
AB_1078264
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Rabbit Anti-Human TNFRSF13C Prestige Antibodies??? Powered by Atlas Antibodies Antibody, Unconjugated
Human TNFRSF13C human
Sigma-Aldrich
HPA003246
(Sigma-Aldrich Cat# HPA003246, RRID:AB_1078264)
unknown
rabbit
Vendor recommendations:
Anti-TNFRSF13C polyclonal antibody
TNFRSF13C See NCBI gene human
Atlas Antibodies Go To Vendor
HPA003246
(Atlas Antibodies Cat# HPA003246, RRID:AB_1078264)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ; Manufacturer approved use: IHC, WB
Anti-TNFRSF13C antibody produced in rabbit
TNFRSF13C antibody produced in rabbit human
Sigma-Aldrich
HPA003246
(Sigma-Aldrich Cat# HPA003246, RRID:AB_1078264)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable