Showing 1 - 3 results out of 3 with the query:
AB_1078316
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Rabbit Anti-Human C14orf104 Prestige Antibodies??? Powered by Atlas Antibodies Antibody, Unconjugated
Human C14orf104 human
Sigma-Aldrich
HPA002894
(Sigma-Aldrich Cat# HPA002894, RRID:AB_1078316)
unknown
rabbit
Vendor recommendations:
7fd627b5-4cef-5f31-bc69-a29435fdde36
Anti-C14orf104 antibody produced in rabbit
C14orf104 antibody produced in rabbit human
Sigma-Aldrich
HPA002894
(Sigma-Aldrich Cat# HPA002894, RRID:AB_1078316)
polyclonal antibody
rabbit
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Immunohistochemistry; Western Blot
8ff8acce-25f5-5194-ab4e-1bee506eb29b
Anti-DNAAF2 polyclonal antibody
DNAAF2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA002894
(Atlas Antibodies Cat# HPA002894, RRID:AB_1078316)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIAVKALQIDSFGLVTCFQQESLDVSQMILGKSQQPESKMQSEFIKEKSATCSNEEKGNLNESVITEEKETDGDHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIK; Manufacturer approved use: IHC
20ee8499-bb59-5d21-80db-4205041474bc