Showing 1 - 3 results out of 3 with the query:
AB_1078402
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-COMT antibody produced in rabbit
Human COMT human
Sigma-Aldrich
HPA001169
(Sigma-Aldrich Cat# HPA001169, RRID:AB_1078402)
unknown
rabbit
Vendor recommendations:
Anti-COMT polyclonal antibody
COMT See NCBI gene human, rat
Atlas Antibodies Go To Vendor
HPA001169
(Atlas Antibodies Cat# HPA001169, RRID:AB_1078402)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIY; Manufacturer approved use: IHC, WB
Anti-COMT antibody produced in rabbit
COMT antibody produced in rabbit human, human
Sigma-Aldrich
HPA001169
(Sigma-Aldrich Cat# HPA001169, RRID:AB_1078402)
polyclonal antibody
rabbit
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunofluorescence; Immunohistochemistry