Showing 1 - 3 results out of 3 with the query:
AB_1078431
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-KIT antibody produced in rabbit
Human KIT human
Sigma-Aldrich
HPA004471
(Sigma-Aldrich Cat# HPA004471, RRID:AB_1078431)
unknown
rabbit
Vendor recommendations:
Anti-KIT antibody produced in rabbit
KIT antibody produced in rabbit human, human
Sigma-Aldrich
HPA004471
(Sigma-Aldrich Cat# HPA004471, RRID:AB_1078431)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Anti-KIT polyclonal antibody
KIT See NCBI gene human
Atlas Antibodies Go To Vendor
HPA004471
(Atlas Antibodies Cat# HPA004471, RRID:AB_1078431)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ; Manufacturer approved use: IHC