Showing 1 - 3 results out of 3 with the query:
AB_1078486
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-CDC42EP1 antibody produced in rabbit
Human CDC42EP1 human
Sigma-Aldrich
HPA006379
(Sigma-Aldrich Cat# HPA006379, RRID:AB_1078486)
unknown
rabbit
Vendor recommendations:
Anti-CDC42EP1 antibody produced in rabbit
CDC42EP1 antibody produced in rabbit human, human
Sigma-Aldrich
HPA006379
(Sigma-Aldrich Cat# HPA006379, RRID:AB_1078486)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Anti-CDC42EP1 polyclonal antibody
CDC42EP1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA006379
(Atlas Antibodies Cat# HPA006379, RRID:AB_1078486)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGV; Manufacturer approved use: ICC-IF, IHC