Showing 1 - 3 results out of 3 with the query:
AB_1078560
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-COX8C antibody produced in rabbit
Human COX8C human
Sigma-Aldrich
HPA003127
(Sigma-Aldrich Cat# HPA003127, RRID:AB_1078560)
unknown
rabbit
Vendor recommendations:
22464fc8-5e4c-547b-a925-43c68f1d1aa4
Anti-COX8C polyclonal antibody
COX8C See NCBI gene human
Atlas Antibodies Go To Vendor
HPA003127
(Atlas Antibodies Cat# HPA003127, RRID:AB_1078560)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAE; Manufacturer approved use: IHC, WB
b4d4953a-84ae-5f3c-b56f-e5ad53796988
Anti-COX8C antibody produced in rabbit
COX8C antibody produced in rabbit human, human
Sigma-Aldrich
HPA003127
(Sigma-Aldrich Cat# HPA003127, RRID:AB_1078560)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
ea6584c4-4f9e-538b-a6ab-e5f336a45315