Showing 1 - 3 results out of 3 with the query:
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Clone ID
Host Organism
Anti-CREM antibody produced in rabbit
Human CREM human
(Sigma-Aldrich Cat# HPA001818, RRID:AB_1078566)
Vendor recommendations:
Anti-CREM polyclonal antibody
CREM See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
(Atlas Antibodies Cat# HPA001818, RRID:AB_1078566)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSD; Manufacturer approved use: IHC, WB
Anti-CREM antibody produced in rabbit
CREM antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA001818, RRID:AB_1078566)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot