Showing 1 - 3 results out of 3 with the query:
AB_1078570
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Rabbit Anti-Human CRKRS Prestige Antibodies??? Powered by Atlas Antibodies Antibody, Unconjugated
Human CRKRS human
Sigma-Aldrich
HPA008038
(Sigma-Aldrich Cat# HPA008038, RRID:AB_1078570)
unknown
rabbit
Vendor recommendations:
ANTI-CDK12 antibody produced in rabbit
ANTI-CDK12 antibody produced in rabbit human
Sigma-Aldrich
HPA008038
(Sigma-Aldrich Cat# HPA008038, RRID:AB_1078570)
polyclonal antibody
rabbit
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Anti-CDK12 polyclonal antibody
CDK12 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA008038
(Atlas Antibodies Cat# HPA008038, RRID:AB_1078570)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAY; Manufacturer approved use: ICC-IF, IHC