Showing 1 - 3 results out of 3 with the query:
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Clone ID
Host Organism
Anti-EBP antibody produced in rabbit
Human EBP human
(Sigma-Aldrich Cat# HPA003130, RRID:AB_1078717)
Vendor recommendations:
Anti-EBP polyclonal antibody
EBP See NCBI gene human
Atlas Antibodies
(Atlas Antibodies Cat# HPA003130, RRID:AB_1078717)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF; Manufacturer approved use: ICC-IF, IHC, WB
Anti-EBP antibody produced in rabbit
EBP antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA003130, RRID:AB_1078717)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry