Showing 1 - 3 results out of 3 with the query:
AB_1078735
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-EMCN antibody produced in rabbit
EMCN human
Sigma-Aldrich
HPA005928
(Sigma-Aldrich Cat# HPA005928, RRID:AB_1078735)
unknown
rabbit
Vendor recommendations:
Anti-EMCN polyclonal antibody
EMCN See NCBI gene human
Atlas Antibodies Go To Vendor
HPA005928
(Atlas Antibodies Cat# HPA005928, RRID:AB_1078735)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIP; Manufacturer approved use: IHC
Anti-EMCN antibody produced in rabbit
EMCN antibody produced in rabbit human
Sigma-Aldrich
HPA005928
(Sigma-Aldrich Cat# HPA005928, RRID:AB_1078735)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry