Showing 1 - 3 results out of 3 with the query:
AB_1078790
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-F12 antibody produced in rabbit
Human F12 human
Sigma-Aldrich
HPA003825
(Sigma-Aldrich Cat# HPA003825, RRID:AB_1078790)
unknown
rabbit
Vendor recommendations:
Anti-F12 polyclonal antibody
F12 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA003825
(Atlas Antibodies Cat# HPA003825, RRID:AB_1078790)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDA; Manufacturer approved use: IHC
Anti-F12 antibody produced in rabbit
F12 antibody produced in rabbit human, human
Sigma-Aldrich
HPA003825
(Sigma-Aldrich Cat# HPA003825, RRID:AB_1078790)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable