Showing 1 - 3 results out of 3 with the query:
AB_1078794
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-F13B antibody produced in rabbit
Human F13B human
Sigma-Aldrich
HPA003827
(Sigma-Aldrich Cat# HPA003827, RRID:AB_1078794)
unknown
rabbit
Vendor recommendations:
c8f2d43f-e876-5801-9bcf-0e9f6fccecca
Anti-F13B antibody produced in rabbit
F13B antibody produced in rabbit human, human
Sigma-Aldrich
HPA003827
(Sigma-Aldrich Cat# HPA003827, RRID:AB_1078794)
polyclonal antibody
rabbit
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunofluorescence; Immunohistochemistry
2358a7a8-d887-563f-941c-4701a10ef56e
Anti-F13B polyclonal antibody
F13B See NCBI gene human
Atlas Antibodies Go To Vendor
HPA003827
(Atlas Antibodies Cat# HPA003827, RRID:AB_1078794)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence FCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEV; Manufacturer approved use: IHC, WB
405e10be-7067-5492-b01f-68661fb86640