Showing 1 - 3 results out of 3 with the query:
AB_1079276
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-LRG1 antibody produced in rabbit
Human LRG1 human
Sigma-Aldrich
HPA001888
(Sigma-Aldrich Cat# HPA001888, RRID:AB_1079276)
unknown
rabbit
Vendor recommendations:
Anti-LRG1 antibody produced in rabbit
LRG1 antibody produced in rabbit human, human
Sigma-Aldrich
HPA001888
(Sigma-Aldrich Cat# HPA001888, RRID:AB_1079276)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-LRG1 polyclonal antibody
LRG1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA001888
(Atlas Antibodies Cat# HPA001888, RRID:AB_1079276)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSG; Manufacturer approved use: IHC, WB