Showing 1 - 3 results out of 3 with the query:
AB_1079286
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-LYN antibody produced in rabbit
Human LYN human
Sigma-Aldrich
HPA001231
(Sigma-Aldrich Cat# HPA001231, RRID:AB_1079286)
unknown
rabbit
Vendor recommendations:
Anti-LYN antibody produced in rabbit
LYN antibody produced in rabbit human, human
Sigma-Aldrich
HPA001231
(Sigma-Aldrich Cat# HPA001231, RRID:AB_1079286)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Western Blot; Other; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-LYN polyclonal antibody
LYN See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
HPA001231
(Atlas Antibodies Cat# HPA001231, RRID:AB_1079286)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPG; Manufacturer approved use: IHC, WB