Showing 1 - 3 results out of 3 with the query:
AB_1079392
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
ANTI-RP5-862P8.2 antibody produced in rabbit
Human M3KL4 human
Sigma-Aldrich
HPA007636
(Sigma-Aldrich Cat# HPA007636, RRID:AB_1079392)
unknown
rabbit
Vendor recommendations:
0e79f5af-f13e-5619-a3ff-fb82d1fd49e5
Anti-RP5-862P8.2 polyclonal antibody
RP5-862P8.2 See NCBI gene human
Atlas Antibodies
HPA007636
(Atlas Antibodies Cat# HPA007636, RRID:AB_1079392)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GNPTPTGATIISATGASALPLCPSPAPHSHLPREVSPKKHSTVHIVPQRRPASLRSRSDLPQAYPQTAVSQLAQTACVVGRPGPHPTQFLAAKERTKSHVPSLLDADVEGQSRDYTVPLCRMRSKTSRPSIYELEKE; Manufacturer approved use: ICC-IF, IHC, WB
c1a49b95-5238-5668-bb76-a3f219ecc0c7
ANTI-RP5-862P8.2 antibody produced in rabbit
ANTI-RP5-862P8.2 antibody produced in rabbit human, human
Sigma-Aldrich
HPA007636
(Sigma-Aldrich Cat# HPA007636, RRID:AB_1079392)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunofluorescence; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
33f95c77-21d6-5bd0-8663-c2991838355f