Showing 1 - 2 results out of 2 with the query:
AB_10793957
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-MAST2 antibody produced in rabbit
MAST2 antibody produced in rabbit human
Sigma-Aldrich
HPA040155
(Sigma-Aldrich Cat# HPA040155, RRID:AB_10793957)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
e67556f5-29b3-52b4-871b-2e2b6ed00dcd
Anti-MAST2 polyclonal antibody
MAST2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA040155
(Atlas Antibodies Cat# HPA040155, RRID:AB_10793957)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRMRNQS; Manufacturer approved use: IHC
6bc54ad4-7b27-5f43-b1d8-c9e7fcba6c4e