Showing 1 - 2 results out of 2 with the query:
AB_10794148
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-QPCTL antibody produced in rabbit
QPCTL antibody produced in rabbit human
Sigma-Aldrich
HPA040797
(Sigma-Aldrich Cat# HPA040797, RRID:AB_10794148)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
afb47cbc-e2b4-5761-aabc-c6b4b9358ed2
Anti-QPCTL polyclonal antibody
QPCTL See NCBI gene human
Atlas Antibodies Go To Vendor
HPA040797
(Atlas Antibodies Cat# HPA040797, RRID:AB_10794148)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDD; Manufacturer approved use: ICC-IF, IHC
48918135-67ea-5611-83e7-5d0b96b1fa54