Showing 1 - 3 results out of 3 with the query:
AB_1079420
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-MTA1 antibody produced in rabbit
Human MTA1 human
Sigma-Aldrich
HPA005544
(Sigma-Aldrich Cat# HPA005544, RRID:AB_1079420)
unknown
rabbit
Vendor recommendations:
80d6d3b5-ec21-59f3-9aad-98bf2c7e685c
Anti-MTA1 antibody produced in rabbit
MTA1 antibody produced in rabbit human, human
Sigma-Aldrich
HPA005544
(Sigma-Aldrich Cat# HPA005544, RRID:AB_1079420)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
846f7c71-9fb4-5955-823b-3e3c166bcf18
Anti-MTA1 polyclonal antibody
MTA1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA005544
(Atlas Antibodies Cat# HPA005544, RRID:AB_1079420)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETK; Manufacturer approved use: ICC-IF, IHC
8370e34a-afe3-5bb9-b879-9860c34690e6