Showing 1 - 3 results out of 3 with the query:
AB_1079441
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-MYO5A antibody produced in rabbit
Human MYO5A human
Sigma-Aldrich
HPA001356
(Sigma-Aldrich Cat# HPA001356, RRID:AB_1079441)
unknown
rabbit
Vendor recommendations:
Anti-MYO5A antibody produced in rabbit
MYO5A antibody produced in rabbit human, human
Sigma-Aldrich
HPA001356
(Sigma-Aldrich Cat# HPA001356, RRID:AB_1079441)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Anti-MYO5A polyclonal antibody
MYO5A See NCBI gene human
Atlas Antibodies Go To Vendor
HPA001356
(Atlas Antibodies Cat# HPA001356, RRID:AB_1079441)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPG; Manufacturer approved use: ICC-IF, IHC