Showing 1 - 2 results out of 2 with the query:
AB_10794613
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-SLC11A1 antibody produced in rabbit
SLC11A1 antibody produced in rabbit human
Sigma-Aldrich
HPA029590
(Sigma-Aldrich Cat# HPA029590, RRID:AB_10794613)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Anti-SLC11A1 polyclonal antibody
SLC11A1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA029590
(Atlas Antibodies Cat# HPA029590, RRID:AB_10794613)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TSPGPQQAPPRETYLSEKIPIPDTKPGTFSLR; Manufacturer approved use: IHC