Showing 1 - 3 results out of 3 with the query:
AB_1079469
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-NLGN3 antibody produced in rabbit
Human NLGN3 human
Sigma-Aldrich
HPA003183
(Sigma-Aldrich Cat# HPA003183, RRID:AB_1079469)
unknown
rabbit
Vendor recommendations:
b040b922-903a-51e1-8fa0-09d27ef6c7e5
Anti-NLGN3 polyclonal antibody
NLGN3 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA003183
(Atlas Antibodies Cat# HPA003183, RRID:AB_1079469)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence APAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTED; Manufacturer approved use: IHC, WB
d69d4929-83b4-5d40-bd5e-4c792d11f91a
Anti-NLGN3 antibody produced in rabbit
NLGN3 antibody produced in rabbit human, human
Sigma-Aldrich
HPA003183
(Sigma-Aldrich Cat# HPA003183, RRID:AB_1079469)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
80595356-077e-5cb0-90c9-8c00e450e657