Showing 1 - 2 results out of 2 with the query:
AB_10795287
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-BRCA1 antibody produced in rabbit
BRCA1 antibody produced in rabbit human
Sigma-Aldrich
HPA034966
(Sigma-Aldrich Cat# HPA034966, RRID:AB_10795287)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Anti-BRCA1 polyclonal antibody
BRCA1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA034966
(Atlas Antibodies Cat# HPA034966, RRID:AB_10795287)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAV; Manufacturer approved use: IHC