Showing 1 - 3 results out of 3 with the query:
AB_1079548
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-CDKN1C antibody produced in rabbit
Human CDKN1C human
Sigma-Aldrich
HPA002924
(Sigma-Aldrich Cat# HPA002924, RRID:AB_1079548)
unknown
rabbit
Vendor recommendations:
Anti-CDKN1C antibody produced in rabbit
CDKN1C antibody produced in rabbit human, human
Sigma-Aldrich
HPA002924
(Sigma-Aldrich Cat# HPA002924, RRID:AB_1079548)
polyclonal antibody
rabbit
Vendor recommendations: Immunofluorescence; Other; Immunohistochemistry; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-CDKN1C polyclonal antibody
CDKN1C See NCBI gene human
Atlas Antibodies Go To Vendor
HPA002924
(Atlas Antibodies Cat# HPA002924, RRID:AB_1079548)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP; Manufacturer approved use: ICC-IF, IHC, WB