Showing 1 - 3 results out of 3 with the query:
AB_1079549
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-GATAD2A antibody produced in rabbit
Human GATAD2A human
Sigma-Aldrich
HPA006759
(Sigma-Aldrich Cat# HPA006759, RRID:AB_1079549)
unknown
rabbit
Vendor recommendations:
77cbff64-887a-555c-af52-552e45b0909d
Anti-GATAD2A antibody produced in rabbit
GATAD2A antibody produced in rabbit human, human
Sigma-Aldrich
HPA006759
(Sigma-Aldrich Cat# HPA006759, RRID:AB_1079549)
polyclonal antibody
rabbit
Vendor recommendations: Other; Western Blot; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
a7cb72f7-ab04-5c65-bc8d-a9e74bedf75f
Anti-GATAD2A polyclonal antibody
GATAD2A See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
HPA006759
(Atlas Antibodies Cat# HPA006759, RRID:AB_1079549)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIP; Manufacturer approved use: ICC-IF, IHC, WB
43934d59-3022-5f25-91d4-5d9c29586c4e