Showing 1 - 2 results out of 2 with the query:
AB_10795538
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-GFER antibody produced in rabbit
GFER antibody produced in rabbit human
Sigma-Aldrich
HPA041227
(Sigma-Aldrich Cat# HPA041227, RRID:AB_10795538)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Anti-GFER polyclonal antibody
GFER See NCBI gene human, rat
Atlas Antibodies Go To Vendor
HPA041227
(Atlas Antibodies Cat# HPA041227, RRID:AB_10795538)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD; Manufacturer approved use: ICC-IF, IHC, WB