Showing 1 - 2 results out of 2 with the query:
AB_10795633
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-ADO antibody produced in rabbit
ADO antibody produced in rabbit human
Sigma-Aldrich
HPA040437
(Sigma-Aldrich Cat# HPA040437, RRID:AB_10795633)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
1b701e1c-406f-59c4-8a06-e7373aa06ca3
Anti-ADO polyclonal antibody
ADO See NCBI gene human
Atlas Antibodies
HPA040437
(Atlas Antibodies Cat# HPA040437, RRID:AB_10795633)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPL; Manufacturer approved use: IHC, WB
e34f50c7-a2d3-52c1-8f1a-b917547339b0